Acetyl tetrapeptide-5
is used in cosmetic eye formulations to decrease puffiness, eye bags, and dark circles by reducing edema and protecting proteins such as SOD from glycation
Alanine
Ala / A · hydrophobic residue · neutral charge
AOD-9604
is studied as an anti-obesity peptide that can reduce weight gain and increase fat oxidation in obese animal models with generally neutral effects on IGF-1 and glucose metabolism in early human trials
Arginine
Arg / R · basic residue · positive charge
Argireline
is a topical cosmetic peptide reported to decrease dynamic wrinkles by partially mimicking the mechanism of botulinum toxin in a non-invasive manner
Asparagine
Asn / N · polar residue · neutral charge
Aspartic acid
Asp / D · acidic residue · negative charge
BPC-157
is investigated for accelerating healing of gastrointestinal mucosa, tendons, ligaments, bone, and nervous tissue in preclinical models, with anti-inflammatory and pro-angiogenic effects
Peptide record
Peptide record
Tesamorelin is a Hormone peptide.
This Peptide is FDA-approved to reduce excess visceral adipose tissue in HIV-associated lipodystrophy and is studied for broader body-composition, NAFLD, and cognitive effects via GH/IGF-1 axis modulation1893
Tesamorelin is a full-length 44-amino-acid GHRH analog with an N-terminal trans-3-hexenoic acid modification that binds GHRHR, activating cAMP/PKA signaling to increase endogenous GH and IGF-1, with improved stability versus native GHRH182893102
Tesamorelin is a Receptor agonist.
44 amino acids
GHRH
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 28102
Tyrosine, Alanine, Aspartic acid, Alanine, Isoleucine, Phenylalanine, Threonine, Asparagine, Serine, Tyrosine, Arginine, Lysine, Valine, Leucine, Glycine, Glutamine, Leucine, Serine, Alanine, Arginine, Lysine, Leucine, Leucine, Glutamine, Aspartic acid, Isoleucine, Methionine, Serine, Arginine, Glutamine, Glutamine, Glycine, Glutamic acid, Serine, Asparagine, Glutamine, Glutamic acid, Arginine, Glycine, Alanine, Arginine, Alanine, Arginine, Leucine
Sequence-derived properties are omitted because the stored sequence includes non-residue terminal modifiers.
No related articles are linked to this peptide yet.