Function
Sermorelin is a Hormone peptide.
This Peptide is used as a diagnostic agent for assessing GH secretory capacity and as a research tool or off-label therapy to increase endogenous GH in GH-deficient or age-related contexts1727
Acetyl tetrapeptide-5
is used in cosmetic eye formulations to decrease puffiness, eye bags, and dark circles by reducing edema and protecting proteins such as SOD from glycation
Alanine
Ala / A · hydrophobic residue · neutral charge
AOD-9604
is studied as an anti-obesity peptide that can reduce weight gain and increase fat oxidation in obese animal models with generally neutral effects on IGF-1 and glucose metabolism in early human trials
Arginine
Arg / R · basic residue · positive charge
Argireline
is a topical cosmetic peptide reported to decrease dynamic wrinkles by partially mimicking the mechanism of botulinum toxin in a non-invasive manner
Asparagine
Asn / N · polar residue · neutral charge
Aspartic acid
Asp / D · acidic residue · negative charge
BPC-157
is investigated for accelerating healing of gastrointestinal mucosa, tendons, ligaments, bone, and nervous tissue in preclinical models, with anti-inflammatory and pro-angiogenic effects
Peptide record
Peptide record
Sermorelin is a Hormone peptide.
This Peptide is used as a diagnostic agent for assessing GH secretory capacity and as a research tool or off-label therapy to increase endogenous GH in GH-deficient or age-related contexts1727
Sermorelin is a synthetic 29-amino-acid peptide identical to the 1–29 N-terminal fragment of human GHRH that stimulates GH synthesis and secretion by binding pituitary GHRH receptors1727120
Sermorelin is a Receptor agonist.
Growth hormone–releasing hormone receptor (GHRHR) on pituitary somatotrophs94103120
29 amino acids
Synthetic peptide corresponding to human hypothalamic GHRH(1–29) 17120
GHRH
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 27
Tyrosine, Alanine, Aspartic acid, Alanine, Isoleucine, Phenylalanine, Threonine, Asparagine, Serine, Tyrosine, Arginine, Lysine, Valine, Leucine, Glycine, Glutamine, Leucine, Serine, Alanine, Arginine, Lysine, Leucine, Leucine, Glutamine, Aspartic acid, Isoleucine, Methionine, Serine, Arginine
Sequence-derived properties are omitted because the stored sequence includes non-residue terminal modifiers.
No related articles are linked to this peptide yet.
This page is reference information, not medical advice, and describes no dosages or administration protocols. Read the full disclaimer.