Mechanism
Cationic amphipathic 37-amino-acid cathelicidin peptide generated from hCAP18 that disrupts microbial membranes and modulates innate immunity, including chemotaxis, cytokine induction, and NET formation.521586
Peptide record
Cationic amphipathic 37-amino-acid cathelicidin peptide generated from hCAP18 that disrupts microbial membranes and modulates innate immunity, including chemotaxis, cytokine induction, and NET formation.521586
Acts as a broad-spectrum antimicrobial and immunomodulatory peptide involved in host defense and wound repair, but can also promote inflammation and cancer cell proliferation in some contexts.5215
Functions as a ligand for CXCR2 on neutrophils and other myeloid cells; LL-37 signaling has also been linked to FPR2 and P2X7 in various cell types.515
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser ([LL-37, 37 aa])86
37 amino acids
Human cathelicidin antimicrobial peptide generated from the CAP-18 precursor.5286
CAMP
No related articles are linked to this peptide yet.